PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G183800.1.p
Common NameSb03g024500, SORBIDRAFT_03g024500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 342aa    MW: 37316.2 Da    PI: 6.079
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G183800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.8e-161461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Sobic.003G183800.1.p 14 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 61
                          788*******************************************97 PP

2Myb_DNA-binding49.51e-1567110146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+++++E++l++ ++k lG++ W+ Ia+ ++ gRt++++k++w++
  Sobic.003G183800.1.p  67 RGSFSQQEEDLIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 110
                           899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-23964IPR009057Homeodomain-like
PROSITE profilePS5129418.404961IPR017930Myb domain
SuperFamilySSF466896.74E-2911108IPR009057Homeodomain-like
SMARTSM007176.8E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-141461IPR001005SANT/Myb domain
CDDcd001671.20E-111761No hitNo description
PROSITE profilePS5129425.07362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2565116IPR009057Homeodomain-like
SMARTSM007173.9E-1566114IPR001005SANT/Myb domain
PfamPF002492.7E-1467110IPR001005SANT/Myb domain
CDDcd001673.45E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGREAAATRP KLRRGLWSPE EDEKLYNHII RYGVGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGSF SQQEEDLIIS LHKILGNRWS QIASQLPGRT DNEIKNFWNS CIKKKLRQRG  120
IDPATHKPLN DDDDVVVAAD DNTVAPHRHQ DDKKLASSTD DQCFAAMGAA AASSDDPLAP  180
HSPTVSFDPL SVTNVPTMQQ GSYGAAHSFG RSDNHLCDYG GVDVVSDAAT TYSAYTGGGD  240
SSSNSNGTWT CGGNNVVGGD PMPPHMDMFG RDAEAVYQQF DPAKYSPWQH QQQHPAAARF  300
DGHNVSSGGA AAGFLIRRDL PDSCFDLARS ALEDEFSVDF L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31101163108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794210.0HF679421.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB15 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457980.10.0hypothetical protein SORBIDRAFT_03g024500
TrEMBLC5XMX80.0C5XMX8_SORBI; Putative uncharacterized protein Sb03g024500
STRINGSb03g024500.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-74myb domain protein 86